GO-acc | Go-name | Ontology | Evidence-code | Evidence-type | PMID |
---|---|---|---|---|---|
GO:0016021 | integral component of membrane | Component | IEA | automatic | - |
GO:0005886 | plasma membrane | Component | IDA | automatic | 12107182 |
GO:0005515 | protein binding | Function | IPI | automatic | 12107182 25416956 |
GO:0032060 | bleb assembly | Process | IDA | automatic | 12107182 |
GO:0008219 | cell death | Process | IDA | automatic | 12107182 |
GO:0016049 | cell growth | Process | IEA | automatic | - |
GO:0008285 | negative regulation of cell proliferation | Process | TAS | automatic | 8996089 |
ID: | EMP3_HUMAN |
Accession: | P54852 |
Name: | Epithelial membrane protein 3 (EMP-3) (Hematopoietic neural membrane protein 1) (HNMP-1) (Protein YMP) |
Class: | reviewed |
Links: | PDB | PFAM | MOPED | GO | TFTCOFc |
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
ID: | A0A024QZF8_HUMAN |
Accession: | A0A024QZF8 |
Name: | Epithelial membrane protein 3, isoform CRA_a |
Class: | unreviewed |
Links: | PDB | PFAM | MOPED | GO | TFTCOFc |
MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
Symbol | GeneID | Sources | |||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
CREM | 1390 |
|